PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma96g00520.1
Common NameZOSMA_96G00520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family HB-other
Protein Properties Length: 170aa    MW: 19842.4 Da    PI: 9.4881
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma96g00520.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.9e-194398156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     +r+ ++++++q++ Le+ F+ + +p+ ++r +L kkl+++ +qV++WFqN+R+k k
  Zosma96g00520.1 43 KRNYHRHSHDQIQNLEAIFKDCANPNVKQRVDLGKKLNMDSQQVRFWFQNKRTKVK 98
                     688999************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.31E-1729100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-1938108IPR009057Homeodomain-like
PROSITE profilePS5007115.62940100IPR001356Homeobox domain
SMARTSM003892.8E-1542104IPR001356Homeobox domain
PfamPF000462.0E-164398IPR001356Homeobox domain
CDDcd000863.78E-1243100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MMYSGSRLDD FDGQERRLSR EVDTNGNQNS IVQYDPMNSN EKKRNYHRHS HDQIQNLEAI  60
FKDCANPNVK QRVDLGKKLN MDSQQVRFWF QNKRTKVKNQ IKNKEISILR QQIEKLQHEK  120
MLLIMESMSK PCCSQCGYHP ANGKILQKDQ EFPTENDRSS QGCVSHSKP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9NHX71e-125A0A0K9NHX7_Z
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.13e-33homeodomain GLABROUS 1